Gene itb12g04120.t1
| Sequence ID | itb12g04120.t1 add to my list | ||
|---|---|---|---|
| Species | Ipomoea triloba | ||
| Alias | No gene alias | ||
| Length | 146aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 146 amino acids
>itb12g04120.t1_IPOTR MGALDYLSNFCTITTRRKKRKPMQTVEIKVKMDCDGCERRVKSAVKNMKGVKSVEVNRKQ SRVTVSGFIDPNKVLRKVKSTGKRAEMWPYVPYNLVYYPYASQAYDKRAPSGYVKNVPQA LPPPNAAEERITYMFSDDNPNACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for itb12g04120.t1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| ipotf_pan_p006208 | orthology | 0 | 1 | 296 | 2.69e-105 |