Gene itb12g25750.t1
| Sequence ID | itb12g25750.t1 add to my list | ||
|---|---|---|---|
| Species | Ipomoea triloba | ||
| Alias | No gene alias | ||
| Length | 140aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 140 amino acids
>itb12g25750.t1_IPOTR MVVVRVPTLDCDGCAAKIRKALLKLKGVDDVDIEMEMKKITVRGYGLEERKVVKAIKRAG KVAEPWPYPVGSSHLASFYRYPTQIAAHYYQSMISSSADLAAPAVHAFFHTPALYSVAVA PDEAFASLFSDDNPHACTIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for itb12g25750.t1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G48970.1 | orthology | 0.678 | 10 | - | - |
| AUR62015981-RA | orthology | 0.63 | 9 | - | - |
| Bv3_055490_mxet.t1 | orthology | 0.663 | 9 | - | - |
| Ca_8_1007.1 | orthology | 0.384 | 4 | - | - |
| Cc02_g02970 | orthology | 0.384 | 4 | - | - |
| Cg9g026790.1 | orthology | 0.477 | 10 | - | - |
| Cm028340.1 | orthology | 0.477 | 10 | - | - |
| Cs9g17280.1 | orthology | 0.477 | 10 | - | - |
| DCAR_009368 | orthology | 0.485 | 8 | - | - |
| FvH4_7g29520.1 | orthology | 0.517 | 11 | - | - |
| HanXRQChr06g0183831 | orthology | 0.555 | 5 | - | - |
| HanXRQChr09g0253621 | orthology | 0.582 | 5 | - | - |
| MELO3C003319.2.1 | orthology | 0.613 | 9 | - | - |
| Manes.14G025900.1 | orthology | 0.55 | 11 | - | - |
| Mba01_g04690.1 | orthology | 0.734 | 8 | - | - |
| Oeu024220.1 | orthology | 0.38 | 5 | - | - |
| PGSC0003DMP400025270 | orthology | 0.296 | 4 | - | - |
| Solyc03g025790.2.1 | orthology | 0.286 | 4 | - | - |
| brana_pan_p044950 | orthology | 0.651 | 11 | - | - |
| braol_pan_p025375 | orthology | 0.651 | 12 | - | - |
| brarr_pan_p005835 | orthology | 0.651 | 12 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_41314.1 | orthology | 0.527 | 12 | - | - |
| capan_pan_p012989 | orthology | 0.308 | 3 | - | - |
| cucsa_pan_p007884 | orthology | 0.58 | 9 | - | - |
| evm_27.model.AmTr_v1.0_scaffold00076.26 | orthology | 0.698 | 6 | - | - |
| ipotf_pan_p021461 | orthology | 0.0142 | 1 | 276 | 2.22e-97 |
| maldo_pan_p005834 | orthology | 0.523 | 11 | - | - |
| maldo_pan_p046866 | orthology | 0.948 | 11 | - | - |
| medtr_pan_p031372 | orthology | 0.509 | 10 | - | - |
| musac_pan_p029616 | orthology | 0.72 | 8 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.004G116300.1 | orthology | 0.524 | 12 | - | - |
| soybn_pan_p030070 | orthology | 0.501 | 11 | - | - |
| thecc_pan_p002573 | orthology | 0.497 | 11 | - | - |
| vitvi_pan_p028565 | orthology | 0.444 | 6 | - | - |