Gene itb13g20500.t1
Sequence ID | itb13g20500.t1 add to my list | ||
---|---|---|---|
Species | Ipomoea triloba | ||
Alias | No gene alias | ||
Length | 231aa | ||
Gene Ontology |
![]()
|
Length: 231 amino acids
>itb13g20500.t1_IPOTR MHKLQGNKSEEGSNEQNPGGIIILGVYIHCKGCAETVRDSLIGFYGVEGIEIDESNHRAT VKGKNADPIMVTERLRKKTEKYVELIFPIPKPKKEPKKEPKKEEPKVIEVILKIYMHCEA CAKEVKHCIHKLPGVQTVDSDMESNTVRVKGNMSPESLVEFISQRAGRHAQVLKVNKVVS QKKDNKDHGETPPDSNKKGGAAAAVYKGYTHELLHAPQLFSDENPNACSIV
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP342504 | Unannotated cluster |
4 | GP464372 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for itb13g20500.t1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_73_71.2 | orthology | 0.864 | 5 | 194.5 | 2e-49 |
Cc11_g17230 | orthology | 0.882 | 5 | 194.1 | 8.7e-50 |
DCAR_003359 | orthology | 1 | 5 | 135.2 | 5.9e-32 |
HanXRQChr01g0027281 | orthology | 0.959 | 3 | - | - |
HanXRQChr08g0209971 | orthology | 0.92 | 3 | 162.2 | 6.4e-40 |
Solyc05g009440.1.1 | orthology | 0.74 | 3 | 185.7 | 3.6e-47 |
capan_pan_p013590 | orthology | 0.795 | 3 | 154 | 2.46e-47 |
ipotf_pan_p016439 | orthology | 0.0353 | 1 | 406 | 3.78e-146 |