Gene itb14g01920.t1
| Sequence ID | itb14g01920.t1 add to my list | ||
|---|---|---|---|
| Species | Ipomoea triloba | ||
| Alias | No gene alias | ||
| Length | 84aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 84 amino acids
>itb14g01920.t1_IPOTR MSGQVCCMELRINLDCAACCRKMKRVLLRMKEIEQHMIERQSCRVSVCGRFDPGDVAIKI RKKMNRRVEILDVQIFTNRDGQPE
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for itb14g01920.t1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| PGSC0003DMP400019266 | orthology | 0.9 | 4 | - | - |
| Solyc05g016190.2.1 | orthology | 0.947 | 4 | - | - |
| capan_pan_p026342 | orthology | 0.876 | 3 | - | - |
| ipotf_pan_p028439 | orthology | 0 | 1 | 174 | 6.34e-59 |