Gene maize_pan_p009159
Sequence ID | maize_pan_p009159 add to my list | ||
---|---|---|---|
Species | Zea mays | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (3/4) | ||
Length | 91aa | ||
Gene Ontology |
![]()
|
Length: 91 amino acids
>maize_pan_p009159_MAIZE MDYRQSYCMTLRMNIDCNGCYQRIRRALLQMRELEKHLIDKKHGRVVVWGAFSPQDVAIK IRKRTNRRVEILDLSEASPAAPEGGPDGHMS
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP109350 | Unannotated cluster |
3 | GP119142 | Unannotated cluster |
4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for maize_pan_p009159
Represented sequence(s):
Unrepresented genome(s):
MAIZE_CML247_v1.0
MAIZE_B73_v4.0
MAIZE_PH207_v1.0
MAIZE_Mo17_v1.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
ORGLA09G0073900.1 | orthology | 0.573 | 5 | 130 | 1.75e-38 |
bradi_pan_p028263 | orthology | 0.509 | 4 | 129 | 2.82e-40 |
musac_pan_p023320 | orthology | 0.796 | 3 | 108 | 2.19e-32 |
orysa_pan_p037625 | orthology | 0.68 | 5 | - | - |
sorbi_pan_p029803 | orthology | 0.152 | 1 | 164 | 6.58e-55 |
tritu_pan_p004118 | orthology | 0.428 | 3 | - | - |
tritu_pan_p024914 | orthology | 0.419 | 3 | - | - |
tritu_pan_p040052 | orthology | 0.408 | 3 | 149 | 1.66e-48 |
tritu_pan_p048949 | orthology | 0.502 | 3 | - | - |