Gene maize_pan_p014797
| Sequence ID | maize_pan_p014797 add to my list | ||
|---|---|---|---|
| Species | Zea mays | ||
| Alias | No gene alias | ||
| Pangenome status | Dispensable (2/4) | ||
| Length | 134aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 134 amino acids
>maize_pan_p014797_MAIZE MAPVILQMDVHCARCARRIRKALKGVHGVEDVWASVDTGLVVVAGYALDASLLRWRVQSR SRRPVVVVSDGAAEDALPPPDSAQMVHLGPPGGYPQYYGWAPAHHQLPLHGRYEAPPAYY GGHDDNPNGCCTMQ
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP245789 | Unannotated cluster |
| 3 | GP349846 | Unannotated cluster |
| 4 | GP475099 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for maize_pan_p014797
Represented sequence(s):
Unrepresented genome(s):
MAIZE_Mo17_v1.0
MAIZE_CML247_v1.0
MAIZE_B73_v4.0
MAIZE_PH207_v1.0
| 1. | 2. | 3. | |
|---|---|---|---|
| 1. Zm00006a015225 | 0.00 | 3.03 | 1.50 |
| 2. ZmMO1703t015418 | 3.03 | 0.00 | 3.03 |
| 3. ZmMO1703t015419 | 1.50 | 3.03 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_19_940.1 | orthology | 1 | 2 | - | - |
| Ca_24_338.2 | orthology | 1 | 2 | - | - |
| Ca_48_570.1 | orthology | 1 | 2 | - | - |
| Ca_67_416.1 | orthology | 1 | 2 | - | - |
| Ca_72_670.1 | orthology | 1 | 2 | - | - |
| Ca_73_14.2 | orthology | 1 | 3 | - | - |
| Ca_74_94.1 | orthology | 1 | 3 | - | - |
| Ca_81_33.3 | orthology | 1 | 3 | - | - |
| Ca_85_991.1 | orthology | 1 | 3 | - | - |
| Ca_90_4.2 | orthology | 1 | 2 | - | - |
| Ca_9_295.1 | orthology | 1 | 3 | - | - |
| Ca_9_642.2 | orthology | 1 | 3 | - | - |
| Cc02_g08260 | orthology | 1 | 3 | - | - |
| Cc04_g13830 | orthology | 1 | 3 | - | - |
| HanXRQChr09g0250511 | orthology | 1 | 3 | - | - |
| HanXRQChr16g0528781 | orthology | 1 | 3 | - | - |
| sorbi_pan_p012760 | orthology | 0.555 | 1 | 130 | 6.5e-40 |