Gene maldo_pan_p018618
Sequence ID | maldo_pan_p018618 add to my list | ||
---|---|---|---|
Species | Malus domestica | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 361aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 361 amino acids
>maldo_pan_p018618_MALDO MGEKKESPKNDGEKKPTDAAPKKDDGLNIFIFKTDIHCEGCAKKIKRAVKNFEGVEQVKT DSAANKLTVTGKVDPAGLKEKLEQKIKKKVDLVSPQPKKDGGGGGGGDKKPAADGKAEKK GEEKKPADNKKPADDKKAAEDKKAKEAPKESAVVLKIRLHCDGCMQKMKSKISKFKGVNN VSFDASKDLVTVKGFMDVKELVPYLKEKFRRAVEVVPPKKDDSGAADKKPKDGGGDKKEK EGAGGDKKEKEGGGEKKDKAVAAGDGEKKEVVAAAGGGGGGGAPKMEMSKMEYNGYPYPP PSYYWYDEGHVYNHNKFVMEAQAHQAHISQGSSSHGYAVPMEHYPAPQMFSDENPNGCSV M
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP071484 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for maldo_pan_p018618
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
CgUng002500.1 | orthology | 0.533 | 7 | 257 | 4.55e-84 |
CgUng019980.1 | orthology | 0.533 | 7 | - | - |
Cm060230.1 | orthology | 0.535 | 5 | 251 | 1.95e-81 |
FvH4_6g16410.1 | orthology | 0.357 | 1 | 333 | 2.12e-113 |
MELO3C024466.2.1 | orthology | 0.59 | 3 | 218 | 3.74e-68 |
Manes.08G010600.1 | orthology | 0.633 | 4 | 224 | 1.02e-70 |
Manes.09G066300.1 | orthology | 0.66 | 4 | - | - |
cucsa_pan_p001888 | orthology | 0.601 | 3 | 217 | 5.11e-68 |
maldo_pan_p021518 | ultra-paralogy | 0.101 | 0 | - | - |
orange1.1t00956.1 | orthology | 0.535 | 6 | 241 | 1.45e-77 |