Gene maldo_pan_p022588
Sequence ID | maldo_pan_p022588 add to my list | ||
---|---|---|---|
Species | Malus domestica | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 148aa | ||
Gene Ontology |
![]()
|
Length: 148 amino acids
>maldo_pan_p022588_MALDO MGALDYLSNFCTVTSTRSKRKAMQTVEIKVKMDCDGCERRVKHAVTSMKGVKTVEVNRKQ SRVTVSGYVEPNKVLKRVKSTGKKRAEFWPYIDQHLVRYPYASGVYDWRAPKGYVRNVVQ AFPASINAPEENMVTLFSDDNVNACSIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for maldo_pan_p022588
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg6g018770.1 | orthology | 0.106 | 2 | 260 | 5.37e-91 |
Cm050050.1 | orthology | 0.106 | 2 | 260 | 9.04e-91 |
Cs6g17860.1 | orthology | 0.106 | 2 | 260 | 5.85e-91 |
Manes.01G115000.1 | orthology | 0.208 | 2 | 252 | 7.2e-88 |
Manes.02G074200.1 | orthology | 0.191 | 2 | - | - |
thecc_pan_p003496 | orthology | 0.166 | 3 | 255 | 6.95e-89 |