Gene maldo_pan_p023210
| Sequence ID | maldo_pan_p023210 add to my list | ||
|---|---|---|---|
| Species | Malus domestica | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 135aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 135 amino acids
>maldo_pan_p023210_MALDO MGKLSMGRVLDRFCISSTGSGSCFCMNWSENLDEFESSPLVTGEKDQFLKLKDVVAGKQT LAFQLKPKMVMLRVSMHCNGCAKKVEKHISKIEGVTSYKVDLESKMVVVIGDVLPFEVLE SISKVKNAEIWNSTC
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for maldo_pan_p023210
Represented sequence(s):
MALDO_Borkh_v3.0.a1
MALDO_GDDH13_v1.1
MALDO_HFTH1
| 1. | 2. | 3. | 4. | |
|---|---|---|---|---|
| 1. MDP0000295039 | 0.00 | -0.00 | -0.00 | -0.00 |
| 2. MDP0000129164 | -0.00 | 0.00 | -0.00 | -0.00 |
| 3. MD15G1188800 | -0.00 | -0.00 | 0.00 | -0.00 |
| 4. HF30570-RA | -0.00 | -0.00 | -0.00 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| FvH4_1g05260.1 | orthology | 0.206 | 1 | 224 | 3.22e-77 |
| MELO3C031348.2.1 | orthology | 0.953 | 3 | 108 | 2.35e-31 |
| cucsa_pan_p005932 | orthology | 1 | 3 | - | - |
| cucsa_pan_p021788 | orthology | 0.91 | 2 | - | - |
| maldo_pan_p051607 | ultra-paralogy | 0.0894 | 0 | - | - |
| maldo_pan_p051649 | ultra-paralogy | 0.358 | 0 | - | - |