Gene maldo_pan_p024825
| Sequence ID | maldo_pan_p024825 add to my list | ||
|---|---|---|---|
| Species | Malus domestica | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 90aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 90 amino acids
>maldo_pan_p024825_MALDO MASQTTTVLKVGMSCQGCVGAVKRVLGKLEGVESYDIDFDAQKVTVKSNLPPETVLQTVS KTGKKTAYWEAEAPAPAEPEAKPAETVAAA
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP239638 | Unannotated cluster |
| 3 | GP341755 | Unannotated cluster |
| 4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for maldo_pan_p024825
Represented sequence(s):
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| FvH4_7g05820.1 | orthology | 0.0591 | 1 | - | - |
| MELO3C012358.2.1 | orthology | 0.371 | 3 | 125 | 2.6e-39 |
| cucsa_pan_p012118 | orthology | 0.349 | 3 | 127 | 2.26e-40 |
| maldo_pan_p006752 | ultra-paralogy | 0.0151 | 0 | - | - |