Gene maldo_pan_p035900
Sequence ID | maldo_pan_p035900 add to my list |
---|---|
Species | Malus domestica |
Alias | No gene alias |
Pangenome status | Specific (1/3) |
Length | 63aa |
Length: 63 amino acids
>maldo_pan_p035900_MALDO MFRTICVLLAIWFSSFLKKAYDKKAPPNMVRKVADTSNITETAMDDRYTVMFSDDNPNAC SIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
cajca.ICPL87119.gnm1.ann1.C.cajan_25723.1 | orthology | 0.458 | 3 | - | - |
maldo_pan_p027373 | ultra-paralogy | 0.274 | 0 | - | - |
maldo_pan_p039810 | ultra-paralogy | 0.304 | 0 | - | - |
maldo_pan_p054037 | ultra-paralogy | 0.263 | 0 | - | - |
phavu.G19833.gnm2.ann1.Phvul.009G027600.1 | orthology | 0.448 | 3 | - | - |
soybn_pan_p021996 | orthology | 0.468 | 2 | - | - |