Gene maldo_pan_p054036
| Sequence ID | maldo_pan_p054036 add to my list |
|---|---|
| Species | Malus domestica |
| Alias | No gene alias |
| Pangenome status | Specific (1/3) |
| Length | 101aa |
Length: 101 amino acids
>maldo_pan_p054036_MALDO MRMEGNISFLIHHFCLTNLVNLTCWLYRIVTKLITILDYAYENMHAGVDSLETDMEKQKA TVTGYVDQRKVLKVVGEEQGGGPDFGRSHTTANTIRMHFNI
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):