Gene medtr_pan_p001385
Sequence ID | medtr_pan_p001385 add to my list | ||
---|---|---|---|
Species | Medicago truncatula | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 286aa | ||
Gene Ontology |
![]()
|
Length: 286 amino acids
>medtr_pan_p001385_MEDTR MKGIEIFCASQASTAICLNTNHASSSSSSNTINHFGGRAIDRHNPIITDPKRTPARDLTV TAPSSPSPLPINPKHVHEKAKKNTTSKLSDKKKKNATKSTHDQKKKSTTTTEKVTEHIAN NYSSKPVDSILRRSWVKPASDLITPPTSSRYLLGDTVSLDGVLDYEPVLGLTKVDDNKKN AQVLHEDEDKHSSKQYSSSSVPKSSSTNQVVVLRVSLHCKGCEGKVRKHLSRMQGVTSFN IDFAAKKVTVVGDVTPLSVMASISKVKTAQIWPESATAEAKKTNTI
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for medtr_pan_p001385
Represented sequence(s):
MEDTR_A17_r5.0
MEDTR_Mt4.0v2
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT2G37390.1 | orthology | 1 | 4 | 157 | 5.14e-47 |
AT3G53530.2 | orthology | 1 | 4 | - | - |
MELO3C003095.2.1 | orthology | 0.931 | 4 | - | - |
brana_pan_p029929 | orthology | 1 | 6 | - | - |
brana_pan_p030312 | orthology | 1 | 6 | 150 | 1.22e-43 |
brana_pan_p031480 | orthology | 1 | 5 | - | - |
brana_pan_p036701 | orthology | 1 | 6 | - | - |
brana_pan_p041953 | orthology | 1 | 5 | - | - |
braol_pan_p003859 | orthology | 1 | 5 | - | - |
braol_pan_p015324 | orthology | 1 | 5 | - | - |
braol_pan_p021666 | orthology | 1 | 5 | - | - |
braol_pan_p031578 | orthology | 1 | 5 | 156 | 3.54e-46 |
brarr_pan_p002630 | orthology | 1 | 6 | - | - |
brarr_pan_p008392 | orthology | 1 | 6 | - | - |
brarr_pan_p026146 | orthology | 1 | 6 | - | - |
brarr_pan_p039884 | orthology | 1 | 5 | - | - |
cicar_pan_p017889 | orthology | 0.184 | 1 | 356 | 2.04e-124 |
cucsa_pan_p020833 | orthology | 0.952 | 4 | - | - |