Gene medtr_pan_p005386
| Sequence ID | medtr_pan_p005386 add to my list | ||
|---|---|---|---|
| Species | Medicago truncatula | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 157aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 157 amino acids
>medtr_pan_p005386_MEDTR MGALDIISELCEFCHVHHGRKLVKRNQLQVVEIKVKMDCEGCERRVKKSVEGMKGVTKVE VEPKQSKLTVTGYVEPNKVLERVKHHTGKKAEFWPYVPYDVVPTPYAPEAYDKKAPPGYV RNVLQDPEASTLARSSPFEVKYTTAFSDDNPNACTIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for medtr_pan_p005386
Represented sequence(s):
MEDTR_A17_r5.0
MEDTR_Mt4.0v2
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT5G66110.1 | orthology | 0.52 | 7 | 220 | 5.67e-75 |
| Cg1g001350.1 | orthology | 0.311 | 4 | 251 | 2.62e-87 |
| Cm173610.1 | orthology | 0.305 | 3 | - | - |
| Cm280940.1 | orthology | 0.305 | 3 | 256 | 6.52e-89 |
| Cs1g25820.1 | orthology | 0.304 | 4 | 256 | 2.97e-89 |
| MELO3C007926.2.1 | orthology | 0.463 | 7 | 231 | 1.97e-79 |
| Manes.01G148900.1 | orthology | 0.475 | 5 | 227 | 1.39e-77 |
| brana_pan_p030902 | orthology | 0.526 | 9 | 202 | 3.38e-68 |
| braol_pan_p039277 | orthology | 0.518 | 8 | 204 | 5.31e-69 |
| brarr_pan_p021369 | orthology | 0.526 | 9 | 202 | 2.73e-68 |
| cucsa_pan_p018650 | orthology | 0.463 | 7 | 230 | 7.55e-79 |
| maldo_pan_p003753 | orthology | 0.274 | 3 | 215 | 3.87e-73 |
| thecc_pan_p011891 | orthology | 0.28 | 1 | 252 | 1.71e-87 |