Gene medtr_pan_p006344
Sequence ID | medtr_pan_p006344 add to my list | ||
---|---|---|---|
Species | Medicago truncatula | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 147aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 147 amino acids
>medtr_pan_p006344_MEDTR MGVLDKLSDYFPEYSSTGKKHKPMQTVEIKVKMDCDGCERRVRNSVAYMKGVKQVEVNRK QSKVTVSGNVDRNRVLKKIQNTGKRAEFWPYIPYNLVAYPYISQAYDKKAPSGYVKNSIQ ALSSPNAMDEKLTNMFSDENPNACSIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for medtr_pan_p006344
Represented sequence(s):
MEDTR_Mt4.0v2
MEDTR_A17_r5.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
cicar_pan_p018098 | orthology | 0.146 | 1 | 258 | 3.89e-90 |