Gene medtr_pan_p015003


Sequence ID medtr_pan_p015003  add to my list
Species Medicago truncatula
Alias No gene alias
Pangenome status Core (2/2)
Length 79aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 79 amino acids

>medtr_pan_p015003_MEDTR
MSSQTVTLKVGMSCEGCVGAVKRVLGKLDGVESYDIDLKEQKVVVKGNVEPDTVLKTVSK
TGKPTAFWEAEAPSETKAQ


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for medtr_pan_p015003



Represented sequence(s):
MEDTR_A17_r5.0
MtrunA17_Chr1g0198341
MEDTR_Mt4.0v2
Medtr1g092670.1
Download sequences FASTA



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
cicar_pan_p009659 orthology 0.0422 1 135 6.36e-44
thecc_pan_p006409 orthology 0.404 2 129 2.32e-41
vitvi_pan_p027163 orthology 0.502 3 129 5.51e-41
vitvi_pan_p043448 orthology 0.518 3 - -
vitvi_pan_p043537 orthology 0.502 3 - -