Gene medtr_pan_p020630


Sequence ID medtr_pan_p020630  add to my list
Species Medicago truncatula
Alias No gene alias
Pangenome status Core (2/2)
Length 71aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 71 amino acids

>medtr_pan_p020630_MEDTR
MANVVEVKVGLHCDDCIKKILKAIKKIQDIETYNVDTKLNKVIVTGNVTTEQVIRVLHKI
GKNASPFEDAA


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP240412 Unannotated cluster
3 GP342479 Unannotated cluster
4 GP464531 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for medtr_pan_p020630



Represented sequence(s):
MEDTR_Mt4.0v2
Medtr3g072000.1
MEDTR_A17_r5.0
MtrunA17_Chr3g0114271
Download sequences FASTA



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
MELO3C019982.2.1 orthology 0.6 5 - -
Manes.07G136400.1 orthology 0.406 4 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_30554.1 orthology 0.191 2 122 1.01e-38
cucsa_pan_p000399 orthology 0.567 5 - -
soybn_pan_p002448 orthology 0.186 1 - -