Gene medtr_pan_p021579
| Sequence ID | medtr_pan_p021579 add to my list | ||
|---|---|---|---|
| Species | Medicago truncatula | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 155aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 155 amino acids
>medtr_pan_p021579_MEDTR MGALDYLSNFCTTVSVTNSTIKRAKRKAMQTVEIKVRMDCDGCERRVRNAVTSLKGVKSV EVNRKQSRVIVSGYVDPNKVLKRIKSTGKVRAQFWPYVEQQLVYYPYAYGAYDKRAPSGF VRNVVQAAPMASSNHQEELLVSLFNDDNVNACSIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for medtr_pan_p021579
Represented sequence(s):
MEDTR_A17_r5.0
MEDTR_Mt4.0v2
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| MELO3C020306.2.1 | orthology | 0.397 | 3 | 206 | 3.76e-69 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_32061.1 | orthology | 0.23 | 3 | 238 | 6.25e-82 |
| cucsa_pan_p006945 | orthology | 0.402 | 3 | 202 | 3.91e-68 |
| phavu.G19833.gnm2.ann1.Phvul.004G001200.1 | orthology | 0.222 | 2 | 237 | 1.22e-81 |
| soybn_pan_p022431 | orthology | 0.35 | 3 | - | - |
| soybn_pan_p025671 | orthology | 0.326 | 3 | 222 | 8.74e-76 |
| soybn_pan_p036295 | orthology | 0.552 | 3 | - | - |
| soybn_pan_p036417 | orthology | 0.483 | 3 | - | - |
| soybn_pan_p037957 | orthology | 0.75 | 3 | - | - |
| soybn_pan_p038110 | orthology | 0.326 | 3 | - | - |
| soybn_pan_p043279 | orthology | 0.598 | 3 | - | - |