Gene medtr_pan_p030129
| Sequence ID | medtr_pan_p030129 add to my list | ||
|---|---|---|---|
| Species | Medicago truncatula | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 110aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 110 amino acids
>medtr_pan_p030129_MEDTR MNAGVDSLEIDMENQKVTVTGYVDKSKVLRMVRKTGRKAEYWPFPYDSEYYPYASQYLDE STFTSSYNYYRHGFNESVHGYFPDQVYSTVPDETVFLFSDDNVNAPCTIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for medtr_pan_p030129
Represented sequence(s):
MEDTR_A17_r5.0
MEDTR_Mt4.0v2
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G56891.1 | orthology | 0.846 | 8 | 103 | 2.43e-29 |
| Ca_28_123.1 | orthology | 0.664 | 9 | - | - |
| Ca_31_155.3 | orthology | 0.621 | 9 | - | - |
| Ca_64_676.1 | orthology | 0.581 | 9 | 100 | 1.87e-28 |
| Ca_78_1273.1 | orthology | 0.621 | 9 | - | - |
| Cc06_g21060 | orthology | 0.536 | 9 | 88.6 | 4.48e-24 |
| Cg6g011520.1 | orthology | 0.251 | 3 | 188 | 3.87e-63 |
| Cs6g10930.1 | orthology | 0.245 | 3 | 188 | 5.44e-63 |
| DCAR_016949 | orthology | 0.681 | 9 | 129 | 3.64e-40 |
| FvH4_2g26780.1 | orthology | 0.351 | 5 | 115 | 6.44e-34 |
| MELO3C019416.2.1 | orthology | 0.396 | 5 | 157 | 3.61e-51 |
| Manes.08G099200.1 | orthology | 0.343 | 5 | 166 | 3.14e-54 |
| Oeu053981.1 | orthology | 0.602 | 10 | 157 | 1.99e-51 |
| brana_pan_p032952 | orthology | 0.994 | 9 | - | - |
| brana_pan_p033418 | orthology | 0.964 | 10 | - | - |
| brana_pan_p049288 | orthology | 0.993 | 8 | 99 | 1.81e-27 |
| braol_pan_p001934 | orthology | 0.998 | 9 | 98.2 | 3.3e-27 |
| braol_pan_p038031 | orthology | 0.941 | 9 | - | - |
| brarr_pan_p006813 | orthology | 0.964 | 10 | - | - |
| brarr_pan_p018750 | orthology | 0.998 | 8 | 98.6 | 2.02e-27 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_46944.1 | orthology | 0.208 | 3 | 193 | 2.01e-65 |
| cucsa_pan_p011351 | orthology | 0.428 | 5 | 172 | 5.76e-57 |
| ipotf_pan_p003030 | orthology | 0.761 | 11 | 136 | 1.53e-42 |
| itb11g01700.t1 | orthology | 0.757 | 11 | 135 | 2.33e-42 |
| maldo_pan_p024328 | orthology | 0.435 | 5 | 116 | 1.12e-34 |
| maldo_pan_p038662 | orthology | 0.342 | 5 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.004G052700.1 | orthology | 0.206 | 2 | 193 | 4.06e-65 |
| soybn_pan_p020075 | orthology | 0.225 | 3 | 199 | 1.1e-67 |
| thecc_pan_p019791 | orthology | 0.269 | 4 | 120 | 1.59e-36 |
| vitvi_pan_p003255 | orthology | 0.393 | 7 | - | - |