Gene musac_pan_p001588
Sequence ID | musac_pan_p001588 add to my list | ||
---|---|---|---|
Species | Musa acuminata | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (3/4) | ||
Length | 142aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 142 amino acids
>musac_pan_p001588_MUSAC MTIVEMCVHMDCAGCESKIRKALQKLEGVDNVEIDMGSQKVTVTGYVDQKKVLKAVRRTG RRAVLWPYQYSAEQHHTFNHQYHQHHPALAQAGVSGPSSSYNYYKHGYDDSRIHGYYQQP AMTGNRTGDIFSDENPNACSVM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for musac_pan_p001588
Represented sequence(s):
Unrepresented genome(s):
MUSAC_Macze1
MUSAC_Macma2
MUSAC_Macbu1
MUSAC_Macba2
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HORVU3Hr1G072940.2 | orthology | 0.547 | 4 | 157 | 2.25e-50 |
Mba03_g16740.1 | orthology | 0.0214 | 1 | 219 | 1.98e-75 |
ORGLA01G0256400.1 | orthology | 0.456 | 3 | 171 | 1.46e-55 |
Sspon.03G0031090-1B | orthology | 0.519 | 3 | - | - |
Sspon.03G0031090-2C | orthology | 0.519 | 3 | 146 | 1.79e-45 |
XP_008813766.1 | orthology | 0.247 | 4 | 220 | 3.91e-75 |
XP_010920018.1 | orthology | 0.26 | 5 | 213 | 4.63e-72 |
bradi_pan_p002062 | orthology | 0.589 | 3 | 157 | 4.61e-50 |
cocnu_pan_p020915 | orthology | 0.268 | 5 | - | - |
orysa_pan_p003551 | orthology | 0.449 | 3 | 174 | 6.76e-57 |
sorbi_pan_p007128 | orthology | 0.518 | 3 | 164 | 6.6e-53 |
tritu_pan_p029517 | orthology | 0.503 | 4 | 169 | 5.44e-55 |