Gene musac_pan_p002002
Sequence ID | musac_pan_p002002 add to my list | ||
---|---|---|---|
Species | Musa acuminata | ||
Alias | No gene alias | ||
Pangenome status | Core (4/4) | ||
Length | 135aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 135 amino acids
>musac_pan_p002002_MUSAC MGRSALVRVLDCLSLAVSPGSCVCMNTWEEEEEDGFEEKSLIKSHVEQVLKIKDVLDGGK TTLAFHLEPKTVVLRVSMHCNGCARKVEKHISKMEGVTSFQVDLANKKVVVVGDITPFEV LKSVSKVKFAELWLT
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for musac_pan_p002002
Represented sequence(s):
MUSAC_Macbu1
MUSAC_Macze1
MUSAC_Macma2
MUSAC_Macba2
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Dr20434 | orthology | 0.671 | 3 | 160 | 5.81e-52 |
Mba01_g17650.1 | orthology | 0 | 1 | 268 | 1.61e-94 |
ORGLA01G0170900.1 | orthology | 1 | 4 | - | - |
XP_008776942.1 | orthology | 0.365 | 2 | - | - |
XP_008809019.1 | orthology | 0.329 | 3 | - | - |
XP_010925099.1 | orthology | 0.358 | 4 | - | - |
XP_010939249.1 | orthology | 0.383 | 3 | - | - |
bradi_pan_p042928 | orthology | 1 | 5 | - | - |
cocnu_pan_p000998 | orthology | 0.409 | 3 | - | - |
cocnu_pan_p007495 | orthology | 0.401 | 4 | - | - |
maize_pan_p021681 | orthology | 1 | 5 | - | - |
sorbi_pan_p016251 | orthology | 1 | 5 | - | - |
tritu_pan_p003582 | orthology | 1 | 5 | - | - |