Gene musac_pan_p005239
| Sequence ID | musac_pan_p005239 add to my list | ||
|---|---|---|---|
| Species | Musa acuminata | ||
| Alias | No gene alias | ||
| Pangenome status | Core (4/4) | ||
| Length | 155aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 155 amino acids
>musac_pan_p005239_MUSAC MGFLEHISEICSFPSSHNKFKKKNQLQTVEIKVRMDCEGCERKVRKAVEGMKGVSSVEIE PKQHKVTVVGYVDPKKVIRRVAWKTGKKAEPWPYVPYDVVAHPYAPGAYDKKAPPGYVRN VVDDPAAAPLARASSTEVKYTTAFSDDNPNNCSVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for musac_pan_p005239
Represented sequence(s):
MUSAC_Macbu1
MUSAC_Macba2
MUSAC_Macma2
MUSAC_Macze1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| HORVU2Hr1G011060.1 | orthology | 0.467 | 5 | - | - |
| HORVU6Hr1G009000.1 | orthology | 0.478 | 3 | - | - |
| HORVU7Hr1G090970.1 | orthology | 0.598 | 3 | - | - |
| Mba04_g33020.1 | orthology | 0 | 1 | 318 | 1.07e-113 |
| ORGLA04G0039000.1 | orthology | 0.463 | 4 | 239 | 1.25e-82 |
| Sspon.05G0013620-1A | orthology | 0.426 | 3 | - | - |
| Sspon.05G0013620-2B | orthology | 0.413 | 3 | 238 | 1.54e-81 |
| Sspon.05G0013620-3C | orthology | 0.413 | 3 | - | - |
| Sspon.05G0013620-4D | orthology | 0.42 | 2 | - | - |
| bradi_pan_p006044 | orthology | 0.493 | 4 | - | - |
| bradi_pan_p040029 | orthology | 0.442 | 2 | 235 | 1.69e-80 |
| maize_pan_p004232 | orthology | 0.394 | 2 | 240 | 7.88e-83 |
| orysa_pan_p007886 | orthology | 0.463 | 4 | 239 | 1.92e-82 |
| sorbi_pan_p013767 | orthology | 0.439 | 3 | 236 | 4.49e-81 |
| tritu_pan_p002673 | orthology | 0.496 | 5 | 243 | 1.35e-83 |
| tritu_pan_p014563 | orthology | 0.454 | 3 | - | - |
| tritu_pan_p034454 | orthology | 0.606 | 3 | - | - |