Gene musac_pan_p007187
Sequence ID | musac_pan_p007187 add to my list | ||
---|---|---|---|
Species | Musa acuminata | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (3/4) | ||
Length | 116aa | ||
Gene Ontology |
![]()
|
Length: 116 amino acids
>musac_pan_p007187_MUSAC MLWICNLMAETVVLKVGMSCQGCVGAVKRVLTKMEGVESFDVDLKEQKVTVKGNVKPEDV FQTVSKTGKKTSFWEAEPEAKEAAPATPTKEDAPSAPTEEDAPSAPDAAADVTTAA
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP239638 | Unannotated cluster |
3 | GP341755 | Unannotated cluster |
4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for musac_pan_p007187
Represented sequence(s):
Unrepresented genome(s):
MUSAC_Macbu1
MUSAC_Macze1
MUSAC_Macma2
MUSAC_Macba2
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HORVU7Hr1G100230.1 | orthology | 0.653 | 3 | 124 | 2.47e-38 |
Mba06_g17710.1 | orthology | 0.0245 | 1 | 159 | 3.39e-52 |
Sspon.04G0025740-1B | orthology | 0.514 | 4 | - | - |
Sspon.04G0025740-2C | orthology | 0.514 | 4 | - | - |
Sspon.04G0025740-3D | orthology | 0.514 | 4 | - | - |
bradi_pan_p000852 | orthology | 0.547 | 2 | 126 | 5.8e-39 |
maize_pan_p017319 | orthology | 0.482 | 2 | 124 | 5.86e-38 |
orysa_pan_p027340 | orthology | 0.423 | 2 | 128 | 1.93e-39 |
sorbi_pan_p000050 | orthology | 0.508 | 3 | - | - |
tritu_pan_p009809 | orthology | 0.699 | 2 | 124 | 5.31e-38 |
tritu_pan_p034911 | orthology | 0.63 | 3 | - | - |
tritu_pan_p050141 | orthology | 0.649 | 2 | - | - |