Gene musac_pan_p014766
| Sequence ID | musac_pan_p014766 add to my list | ||
|---|---|---|---|
| Species | Musa acuminata | ||
| Alias | No gene alias | ||
| Pangenome status | Dispensable (3/4) | ||
| Length | 89aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 89 amino acids
>musac_pan_p014766_MUSAC MSHKFCCMTMRINIDCNGCYRKINRILLQTQGLESHWIEQKQCMVSVCGVFVPQDMAIRL RKKTNRRVEILEIKEVDISNDGSITQKPP
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for musac_pan_p014766
Represented sequence(s):
Unrepresented genome(s):
MUSAC_Macze1
MUSAC_Macba2
MUSAC_Macma2
MUSAC_Macbu1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Mba09_g23440.1 | orthology | 0.0706 | 1 | 162 | 3.94e-54 |
| XP_010909619.1 | orthology | 0.388 | 4 | 137 | 1.44e-43 |
| XP_017700247.1 | orthology | 0.366 | 3 | 142 | 7.02e-46 |
| cocnu_pan_p015513 | orthology | 0.397 | 4 | 137 | 9.12e-44 |