Gene musac_pan_p034720
Sequence ID | musac_pan_p034720 add to my list | ||
---|---|---|---|
Species | Musa acuminata | ||
Alias | No gene alias | ||
Pangenome status | Specific (1/4) | ||
Length | 155aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 155 amino acids
>musac_pan_p034720_MUSAC MGLLEHVSELCSVSRSRKKLKKNKQLQTVELKVRMDCEGCERRVRKAVEGMKGVSSVEIE PKHKKVTVIGFVDPKKVIKRVEWKTGKKAEPWPYVPYDVVPHPYAPGAYDKKAPPGYVRN VLDDPDAAPLARASSTEVKYTTAFSDDNPNSCTIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for musac_pan_p034720
Represented sequence(s):
Unrepresented genome(s):
MUSAC_Macbu1
MUSAC_Macba2
MUSAC_Macma2
MUSAC_Macze1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HORVU2Hr1G011060.1 | orthology | 0.468 | 5 | - | - |
HORVU6Hr1G009000.1 | orthology | 0.479 | 3 | 222 | 9.63e-75 |
HORVU7Hr1G090970.1 | orthology | 0.599 | 3 | - | - |
Mba04_g22800.1 | orthology | 0.0422 | 1 | 298 | 1.3e-105 |
ORGLA04G0039000.1 | orthology | 0.464 | 4 | - | - |
Sspon.05G0013620-1A | orthology | 0.427 | 3 | - | - |
Sspon.05G0013620-2B | orthology | 0.414 | 3 | - | - |
Sspon.05G0013620-3C | orthology | 0.414 | 3 | - | - |
Sspon.05G0013620-4D | orthology | 0.42 | 2 | - | - |
bradi_pan_p006044 | orthology | 0.494 | 4 | - | - |
bradi_pan_p040029 | orthology | 0.442 | 2 | - | - |
maize_pan_p004232 | orthology | 0.395 | 2 | - | - |
orysa_pan_p007886 | orthology | 0.464 | 4 | - | - |
sorbi_pan_p013767 | orthology | 0.44 | 3 | - | - |
tritu_pan_p002673 | orthology | 0.496 | 5 | - | - |
tritu_pan_p014563 | orthology | 0.455 | 3 | - | - |
tritu_pan_p034454 | orthology | 0.607 | 3 | - | - |