Gene musac_pan_p042970
| Sequence ID | musac_pan_p042970 add to my list | ||
|---|---|---|---|
| Species | Musa acuminata | ||
| Alias | No gene alias | ||
| Pangenome status | Specific (1/4) | ||
| Length | 149aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 149 amino acids
>musac_pan_p042970_MUSAC MGGTLECFSNFLGSGRRHKKRKQFQTVELKVRMDCEGCELKVRNALSTMRGVQSVDINRK QYKVTVTGYVEPHKVIKRVQSTGKKAELWPYVPYNLVAHPYVAPTYDKKAPPGYVRNMEV IAVSSQVVRPEDQLTSLFSDDNPNACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for musac_pan_p042970
Represented sequence(s):
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| HORVU4Hr1G017070.3 | orthology | 0.828 | 3 | - | - |
| HORVU5Hr1G057730.1 | orthology | 0.347 | 4 | - | - |
| Mba03_g04290.1 | orthology | 0.0211 | 1 | 300 | 1.43e-106 |
| ORGLA08G0122800.1 | orthology | 0.725 | 3 | - | - |
| ORGLA09G0055900.1 | orthology | 0.38 | 3 | - | - |
| Sspon.02G0015890-1A | orthology | 0.395 | 3 | - | - |
| Sspon.02G0015890-1P | orthology | 0.395 | 3 | - | - |
| Sspon.02G0015890-2B | orthology | 0.401 | 3 | - | - |
| Sspon.02G0015890-3C | orthology | 0.394 | 2 | - | - |
| Sspon.06G0006630-1A | orthology | 0.825 | 3 | - | - |
| Sspon.06G0006630-2B | orthology | 0.837 | 3 | - | - |
| Sspon.06G0006630-3D | orthology | 0.833 | 3 | - | - |
| bradi_pan_p018769 | orthology | 0.74 | 2 | - | - |
| bradi_pan_p035294 | orthology | 0.393 | 3 | - | - |
| maize_pan_p015391 | orthology | 0.839 | 4 | - | - |
| maize_pan_p019318 | orthology | 0.47 | 3 | - | - |
| maize_pan_p026014 | orthology | 0.394 | 2 | - | - |
| orysa_pan_p001816 | orthology | 0.725 | 3 | - | - |
| orysa_pan_p036963 | orthology | 0.38 | 3 | - | - |
| sorbi_pan_p005802 | orthology | 0.839 | 4 | - | - |
| sorbi_pan_p010711 | orthology | 0.39 | 2 | - | - |
| tritu_pan_p031184 | orthology | 0.791 | 3 | - | - |
| tritu_pan_p036816 | orthology | 0.347 | 4 | - | - |