Gene orange1.1t02606.2


Sequence ID orange1.1t02606.2  add to my list
Species Citrus sinensis
Alias No gene alias
Length 345aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 345 amino acids

>orange1.1t02606.2_CITSI
MGEEEKKPPAAEEKKPEEAKKEEAAEKPQEKPAAAEEKKPAPEESKDAKAAKEEQSPPPP
KEIVLKVYMHCEGCARKVRRCLKGFEGVEDVITDCKTHKVIVKGEKADPLKVLDRVQRKS
HRQVELLSPIPKPTAAEEEKKAEEKAPPKPEEKKEEPQVIIVVLKVHMHCEGCSLEIKKR
ILRMEGVESAEPDLKNSQVTVKGVFDPPKLVDYVYKRTGKHAVIVKQEPERKEEKCGGGD
GGGGDGAANKEEKKGGGGGENKENKAAAGEQENQEKKEGDNKKSNDDEAKAAAADATAAT
EETTVVELKKNINEYYYYPQRYAMEMYAYPPQIFSDENPNACSVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP040674 Unannotated cluster
4 GP070448 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for orange1.1t02606.2



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cg7g010440.1 orthology 0.0082 2 270.8 1.1e-72
Cm018610.1 orthology 0.0101 2 270.8 1.9e-72
FvH4_5g08650.1 orthology 0.378 5 228.8 5.2e-60
Manes.06G121400.1 orthology 0.255 2 233.8 1.9e-61
Manes.14G049200.1 orthology 0.27 2 - -
maldo_pan_p003643 orthology 0.396 5 254 2.3e-82
maldo_pan_p029843 orthology 0.397 5 - -
thecc_pan_p013659 orthology 0.331 3 249 1.57e-80
vitvi_pan_p029254 orthology 0.392 5 254 9.45e-83