Gene orange1.1t02606.2
Sequence ID | orange1.1t02606.2 add to my list | ||
---|---|---|---|
Species | Citrus sinensis | ||
Alias | No gene alias | ||
Length | 345aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 345 amino acids
>orange1.1t02606.2_CITSI MGEEEKKPPAAEEKKPEEAKKEEAAEKPQEKPAAAEEKKPAPEESKDAKAAKEEQSPPPP KEIVLKVYMHCEGCARKVRRCLKGFEGVEDVITDCKTHKVIVKGEKADPLKVLDRVQRKS HRQVELLSPIPKPTAAEEEKKAEEKAPPKPEEKKEEPQVIIVVLKVHMHCEGCSLEIKKR ILRMEGVESAEPDLKNSQVTVKGVFDPPKLVDYVYKRTGKHAVIVKQEPERKEEKCGGGD GGGGDGAANKEEKKGGGGGENKENKAAAGEQENQEKKEGDNKKSNDDEAKAAAADATAAT EETTVVELKKNINEYYYYPQRYAMEMYAYPPQIFSDENPNACSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for orange1.1t02606.2
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg7g010440.1 | orthology | 0.0082 | 2 | 270.8 | 1.1e-72 |
Cm018610.1 | orthology | 0.0101 | 2 | 270.8 | 1.9e-72 |
FvH4_5g08650.1 | orthology | 0.378 | 5 | 228.8 | 5.2e-60 |
Manes.06G121400.1 | orthology | 0.255 | 2 | 233.8 | 1.9e-61 |
Manes.14G049200.1 | orthology | 0.27 | 2 | - | - |
maldo_pan_p003643 | orthology | 0.396 | 5 | 254 | 2.3e-82 |
maldo_pan_p029843 | orthology | 0.397 | 5 | - | - |
thecc_pan_p013659 | orthology | 0.331 | 3 | 249 | 1.57e-80 |
vitvi_pan_p029254 | orthology | 0.392 | 5 | 254 | 9.45e-83 |