Gene orange1.1t04018.1
| Sequence ID | orange1.1t04018.1 add to my list | ||
|---|---|---|---|
| Species | Citrus sinensis | ||
| Alias | No gene alias | ||
| Length | 416aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 416 amino acids
>orange1.1t04018.1_CITSI MVLLCKGVYSEILDSVLNRVVAEEALELDSPSDSVTNSNSAQKAISNKGADQLVTFILIV HGYSYVNGVELFVKQIEGVKRVKGDSNSIKLEVTGMVDPWKIQELVEKETKKKVELIFPL TQMAAKRVDNQISEEKLKRKKKIHRNDIGSKQTEEGTYVLKIKLCCDSCNQKLRKIMKIK GLETVNMDVQEDLVKVKGTVDITEVRSYIKDELKKDVVIIFPAEVVIPTKKDDGAAYKKE KDAGTTRKKDRDDKATNKKDDGNNATIDKKYRGAITVYEKFEGPSMVYKKNEGIDAVDEK TKGNATVDRKDKGTTPTDAKSTGSATSDDKYKDGGREKGKDYVFNDEKDKAGGRDTKQHR RDKDGGVMRNENPKTYLNYDGRKVNNEYDYYSPLKYSNGIDQMFSDENPNSYCSIL
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP481286 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for orange1.1t04018.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| CgUng002530.2 | orthology | 0.0131 | 2 | 571.2 | 4.9e-163 |
| Cm060200.2 (RBH withCm060200.1 ) | orthology | 0.0151 | 2 | 572.8 | 2.8e-163 |
| MELO3C015336.2.1 | orthology | 1 | 5 | - | - |
| XP_019703834.1 | orthology | 1 | 3 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_06806.1 | orthology | 1 | 5 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_06837.1 | orthology | 1 | 5 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_10208.1 | orthology | 1 | 4 | - | - |
| cicar_pan_p020684 | orthology | 1 | 4 | - | - |
| cocnu_pan_p025153 | orthology | 1 | 2 | - | - |
| cocnu_pan_p029889 | orthology | 1 | 3 | - | - |
| cucsa_pan_p005094 | orthology | 1 | 5 | - | - |
| medtr_pan_p026239 | orthology | 1 | 4 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.006G093700.1 | orthology | 1 | 3 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.007G181500.1 | orthology | 1 | 4 | - | - |
| soybn_pan_p003331 | orthology | 1 | 5 | - | - |
| soybn_pan_p012422 | orthology | 1 | 5 | - | - |
| soybn_pan_p013228 | orthology | 1 | 4 | - | - |
| soybn_pan_p013486 | orthology | 1 | 4 | - | - |