Gene phavu.G19833.gnm2.ann1.Phvul.003G099700.1
Sequence ID | phavu.G19833.gnm2.ann1.Phvul.003G099700.1 add to my list | ||
---|---|---|---|
Species | Phaseolus vulgaris | ||
Alias | No gene alias | ||
Length | 128aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 128 amino acids
>phavu.G19833.gnm2.ann1.Phvul.003G099700.1_PHAVU MGKNKKVEPNTLITIEYKVSMYCNECERTVAKTIIKCKGVEKFITDMNKNRVVVTGRIDP MKVMKKLKKKTGKRVEIVSNKDEEAKDESHESDKLVVMYQFSLENDCCIETEAMMIFSDE NPNACALM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP345758 | Unannotated cluster |
4 | GP467256 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.003G099700.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT3G21490.1 | orthology | 1 | 10 | 104.4 | 5.5e-23 |
Ca_27_985.2 | orthology | 1 | 11 | - | - |
Ca_34_139.2 | orthology | 1 | 11 | - | - |
Ca_43_446.2 | orthology | 1 | 10 | - | - |
Cc03_g02440 | orthology | 1 | 10 | 94 | 6.8e-20 |
Cg9g003840.1 | orthology | 0.761 | 5 | 97.1 | 8.4e-21 |
Cm135610.1 | orthology | 0.793 | 5 | 116.3 | 2.3e-26 |
Cs9g05250.1 | orthology | 0.676 | 4 | 105.9 | 2e-23 |
DCAR_030575 | orthology | 1 | 9 | 97.1 | 1e-20 |
FvH4_3g29750.1 | orthology | 0.867 | 6 | 136.7 | 1e-32 |
FvH4_4g16960.1 | orthology | 0.863 | 6 | - | - |
HanXRQChr08g0226491 | orthology | 1 | 9 | 100.5 | 1.3e-21 |
MELO3C021374.2.1 | orthology | 0.989 | 7 | 118.6 | 2.4e-27 |
Manes.15G018700.1 | orthology | 1 | 8 | 102.1 | 3.1e-22 |
Solyc03g098650.2.1 | orthology | 1 | 9 | 100.9 | 6.5e-22 |
brana_pan_p026722 | orthology | 1 | 12 | 109 | 1.66e-31 |
braol_pan_p034893 | orthology | 1 | 11 | 108 | 2.13e-31 |
braol_pan_p054032 | orthology | 1 | 10 | - | - |
brarr_pan_p010495 | orthology | 1 | 12 | 108 | 2.69e-31 |
cajca.ICPL87119.gnm1.ann1.C.cajan_04222.1 | orthology | 0.279 | 2 | 197.2 | 7.1e-51 |
cicar_pan_p022803 | orthology | 0.36 | 4 | 167 | 2.45e-55 |
cucsa_pan_p017292 | orthology | 1 | 7 | 119 | 4.83e-36 |
medtr_pan_p033077 | orthology | 0.398 | 4 | 189 | 1.34e-63 |
soybn_pan_p008694 | orthology | 0.261 | 1 | 189 | 3.1e-63 |
soybn_pan_p032351 | orthology | 0.295 | 1 | - | - |
thecc_pan_p001371 | orthology | 0.824 | 7 | 130 | 3.9e-40 |
vitvi_pan_p022438 | orthology | 1 | 7 | 100 | 3.18e-28 |
vitvi_pan_p032656 | orthology | 1 | 7 | - | - |