Gene phavu.G19833.gnm2.ann1.Phvul.004G001200.1


Sequence ID phavu.G19833.gnm2.ann1.Phvul.004G001200.1  add to my list
Species Phaseolus vulgaris
Alias No gene alias
Length 150aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 150 amino acids

>phavu.G19833.gnm2.ann1.Phvul.004G001200.1_PHAVU
MGALDYLSNFCTVTTTRTKHKAMQTVEIKVRMDCDGCERRVRNAVTSLKGVKSVEVNRKQ
SRVVVSGYVDPNKVLKRVRSTGKVRAKFWPYVEQHLVYYPYAPGAYDRRAPSGYVRNVVQ
AFPDHSSNAPPQENFLSFFSDDNVHACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.004G001200.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
MELO3C020306.2.1 orthology 0.336 4 237.3 5.5e-63
cajca.ICPL87119.gnm1.ann1.C.cajan_32061.1 orthology 0.0927 2 277.7 4.8e-75
cucsa_pan_p006945 orthology 0.341 4 233 2.18e-80
medtr_pan_p021579 orthology 0.222 2 240 6.25e-83
soybn_pan_p022431 orthology 0.213 2 - -
soybn_pan_p025671 orthology 0.189 2 253 3.38e-88
soybn_pan_p036295 orthology 0.415 2 - -
soybn_pan_p036417 orthology 0.346 2 - -
soybn_pan_p037957 orthology 0.613 2 - -
soybn_pan_p038110 orthology 0.189 2 - -
soybn_pan_p043279 orthology 0.461 2 - -