Gene phavu.G19833.gnm2.ann1.Phvul.004G052700.1
Sequence ID | phavu.G19833.gnm2.ann1.Phvul.004G052700.1 add to my list | ||
---|---|---|---|
Species | Phaseolus vulgaris | ||
Alias | No gene alias | ||
Length | 146aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 146 amino acids
>phavu.G19833.gnm2.ann1.Phvul.004G052700.1_PHAVU MFGWRKKKLPNVLSIVELKVHMDCQGCEGRIRRAISKLNGVDSLDIDMDQQKVTVTGYVE KGKVLRSVRRTGRRAEYWPFPYDSEYYPYASQYLDESTFSSTYNYYRHGYNESVYGYFPD QAYCTVQDETVFLFSDDNVHAPCVIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.004G052700.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT3G56891.1 | orthology | 0.893 | 9 | 149.1 | 2.2e-36 |
Ca_28_123.1 | orthology | 0.712 | 10 | - | - |
Ca_31_155.3 | orthology | 0.668 | 10 | - | - |
Ca_64_676.1 | orthology | 0.628 | 10 | - | - |
Ca_78_1273.1 | orthology | 0.668 | 10 | - | - |
Cc06_g21060 | orthology | 0.583 | 10 | 116 | 1.52e-34 |
Cg6g011520.1 | orthology | 0.298 | 4 | 244.2 | 4.9e-65 |
Cs6g10930.1 | orthology | 0.292 | 4 | 238 | 3.8e-63 |
DCAR_016949 | orthology | 0.729 | 10 | 125 | 3.41e-38 |
FvH4_2g26780.1 | orthology | 0.398 | 6 | 169.5 | 1.6e-42 |
MELO3C019416.2.1 | orthology | 0.443 | 6 | 158.7 | 2.4e-39 |
Manes.08G099200.1 | orthology | 0.391 | 6 | 172.9 | 1.6e-43 |
Oeu053981.1 | orthology | 0.649 | 11 | 152.9 | 2.4e-37 |
brana_pan_p032952 | orthology | 1 | 10 | - | - |
brana_pan_p033418 | orthology | 1 | 11 | - | - |
brana_pan_p049288 | orthology | 1 | 9 | 145 | 4.95e-45 |
braol_pan_p001934 | orthology | 1 | 10 | 144 | 9.03e-45 |
braol_pan_p038031 | orthology | 0.988 | 10 | - | - |
brarr_pan_p006813 | orthology | 1 | 11 | - | - |
brarr_pan_p018750 | orthology | 1 | 9 | 145 | 3.88e-45 |
cajca.ICPL87119.gnm1.ann1.C.cajan_46944.1 | orthology | 0.106 | 2 | 227.3 | 7.3e-60 |
cucsa_pan_p011351 | orthology | 0.475 | 6 | 213 | 1.83e-72 |
ipotf_pan_p003030 | orthology | 0.808 | 12 | 194 | 9.99e-65 |
itb11g01700.t1 | orthology | 0.804 | 12 | 196.4 | 1.4e-50 |
maldo_pan_p024328 | orthology | 0.482 | 6 | - | - |
maldo_pan_p038662 | orthology | 0.389 | 6 | 170 | 4.19e-55 |
medtr_pan_p030129 | orthology | 0.206 | 2 | 195 | 1.16e-65 |
soybn_pan_p020075 | orthology | 0.123 | 2 | 216 | 4.74e-74 |
thecc_pan_p019791 | orthology | 0.317 | 5 | 172 | 2.92e-56 |
vitvi_pan_p003255 | orthology | 0.44 | 8 | 151 | 5.53e-48 |