Gene phavu.G19833.gnm2.ann1.Phvul.004G052700.1


Sequence ID phavu.G19833.gnm2.ann1.Phvul.004G052700.1  add to my list
Species Phaseolus vulgaris
Alias No gene alias
Length 146aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 146 amino acids

>phavu.G19833.gnm2.ann1.Phvul.004G052700.1_PHAVU
MFGWRKKKLPNVLSIVELKVHMDCQGCEGRIRRAISKLNGVDSLDIDMDQQKVTVTGYVE
KGKVLRSVRRTGRRAEYWPFPYDSEYYPYASQYLDESTFSSTYNYYRHGYNESVYGYFPD
QAYCTVQDETVFLFSDDNVHAPCVIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.004G052700.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT3G56891.1 orthology 0.893 9 149.1 2.2e-36
Ca_28_123.1 orthology 0.712 10 - -
Ca_31_155.3 orthology 0.668 10 - -
Ca_64_676.1 orthology 0.628 10 - -
Ca_78_1273.1 orthology 0.668 10 - -
Cc06_g21060 orthology 0.583 10 116 1.52e-34
Cg6g011520.1 orthology 0.298 4 244.2 4.9e-65
Cs6g10930.1 orthology 0.292 4 238 3.8e-63
DCAR_016949 orthology 0.729 10 125 3.41e-38
FvH4_2g26780.1 orthology 0.398 6 169.5 1.6e-42
MELO3C019416.2.1 orthology 0.443 6 158.7 2.4e-39
Manes.08G099200.1 orthology 0.391 6 172.9 1.6e-43
Oeu053981.1 orthology 0.649 11 152.9 2.4e-37
brana_pan_p032952 orthology 1 10 - -
brana_pan_p033418 orthology 1 11 - -
brana_pan_p049288 orthology 1 9 145 4.95e-45
braol_pan_p001934 orthology 1 10 144 9.03e-45
braol_pan_p038031 orthology 0.988 10 - -
brarr_pan_p006813 orthology 1 11 - -
brarr_pan_p018750 orthology 1 9 145 3.88e-45
cajca.ICPL87119.gnm1.ann1.C.cajan_46944.1 orthology 0.106 2 227.3 7.3e-60
cucsa_pan_p011351 orthology 0.475 6 213 1.83e-72
ipotf_pan_p003030 orthology 0.808 12 194 9.99e-65
itb11g01700.t1 orthology 0.804 12 196.4 1.4e-50
maldo_pan_p024328 orthology 0.482 6 - -
maldo_pan_p038662 orthology 0.389 6 170 4.19e-55
medtr_pan_p030129 orthology 0.206 2 195 1.16e-65
soybn_pan_p020075 orthology 0.123 2 216 4.74e-74
thecc_pan_p019791 orthology 0.317 5 172 2.92e-56
vitvi_pan_p003255 orthology 0.44 8 151 5.53e-48