Gene phavu.G19833.gnm2.ann1.Phvul.004G116300.1
| Sequence ID | phavu.G19833.gnm2.ann1.Phvul.004G116300.1 add to my list | ||
|---|---|---|---|
| Species | Phaseolus vulgaris | ||
| Alias | No gene alias | ||
| Length | 138aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 138 amino acids
>phavu.G19833.gnm2.ann1.Phvul.004G116300.1_PHAVU MSNMIEVRVPNLDCEGCASKLKKALFKLKGVDEVEVEMESQKITVRGYGLEEKKVLKAIK RTGKVAEPWPFPGHAHFSSFYKYPSYIVNHYYDAHKSEATNGVHTFFHTPAVYSVAVASD EAFASLFSDDNPHACTIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.004G116300.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G48970.1 | orthology | 0.319 | 5 | 217.6 | 4.8e-57 |
| AUR62015981-RA | orthology | 0.434 | 8 | 222.2 | 3.3e-58 |
| Bv3_055490_mxet.t1 | orthology | 0.467 | 8 | 219.9 | 9e-58 |
| Ca_8_1007.1 | orthology | 0.361 | 11 | 220.7 | 1.5e-57 |
| Cc02_g02970 | orthology | 0.361 | 11 | 220.3 | 6.8e-58 |
| Cg9g026790.1 | orthology | 0.187 | 7 | 243.4 | 7.8e-65 |
| Cm028340.1 | orthology | 0.187 | 7 | 243.4 | 1.3e-64 |
| Cs9g17280.1 | orthology | 0.187 | 7 | 243.4 | 8.5e-65 |
| DCAR_009368 | orthology | 0.44 | 13 | 218.8 | 2.4e-57 |
| FvH4_7g29520.1 | orthology | 0.227 | 8 | 233.4 | 8.4e-62 |
| HanXRQChr06g0183831 | orthology | 0.443 | 8 | - | - |
| HanXRQChr09g0253621 | orthology | 0.47 | 8 | 214.5 | 6.6e-56 |
| MELO3C003319.2.1 | orthology | 0.417 | 8 | 192.6 | 1.4e-49 |
| Manes.14G025900.1 | orthology | 0.26 | 8 | 240.4 | 7.9e-64 |
| Mba01_g04690.1 | orthology | 0.689 | 13 | 182.6 | 1.9e-46 |
| Oeu024220.1 | orthology | 0.336 | 10 | 231.9 | 3.8e-61 |
| PGSC0003DMP400025270 | orthology | 0.354 | 13 | 226.5 | 1.1e-59 |
| Solyc03g025790.2.1 | orthology | 0.344 | 13 | 225.3 | 2.5e-59 |
| brana_pan_p044950 | orthology | 0.292 | 6 | 223 | 3.45e-76 |
| braol_pan_p025375 | orthology | 0.292 | 7 | 225 | 4.07e-77 |
| brarr_pan_p005835 | orthology | 0.292 | 7 | 225 | 3.63e-77 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_41314.1 | orthology | 0.0514 | 1 | 266.9 | 7.8e-72 |
| capan_pan_p012989 | orthology | 0.367 | 12 | 229 | 5.52e-79 |
| cucsa_pan_p007884 | orthology | 0.384 | 8 | 199 | 6.22e-67 |
| evm_27.model.AmTr_v1.0_scaffold00076.26 | orthology | 0.653 | 11 | 190.7 | 4.7e-49 |
| ipotf_pan_p019855 | orthology | 0.366 | 12 | 210 | 1.58e-71 |
| ipotf_pan_p021461 | orthology | 0.538 | 12 | - | - |
| itb03g13280.t1 | orthology | 0.366 | 12 | 212.2 | 2.4e-55 |
| itb12g25750.t1 | orthology | 0.524 | 12 | - | - |
| maldo_pan_p005834 | orthology | 0.233 | 8 | 236 | 9.31e-82 |
| maldo_pan_p046866 | orthology | 0.657 | 8 | - | - |
| medtr_pan_p031372 | orthology | 0.0812 | 3 | 259 | 5.53e-91 |
| musac_pan_p029616 | orthology | 0.676 | 13 | 180 | 1.29e-59 |
| soybn_pan_p030070 | orthology | 0.046 | 2 | 235 | 1.88e-81 |
| thecc_pan_p002573 | orthology | 0.207 | 8 | 247 | 4.33e-86 |
| vitvi_pan_p028565 | orthology | 0.279 | 7 | 223 | 1.92e-76 |