Gene phavu.G19833.gnm2.ann1.Phvul.004G158700.1


Sequence ID phavu.G19833.gnm2.ann1.Phvul.004G158700.1  add to my list
Species Phaseolus vulgaris
Alias No gene alias
Length 115aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 115 amino acids

>phavu.G19833.gnm2.ann1.Phvul.004G158700.1_PHAVU
MLKIPSESFLFPLGLQYFCMVKRINIDCNGCYRKVKRAILDMPELDSHLLEKQQTNVVVC
GRFIPQDVAIKIKKKTNRRVEILDIQDLSDSNEEEDQKPMTNNWTTQNQIETCLV




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP109350 Unannotated cluster
3 GP119142 Unannotated cluster
4 GP077996 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR036163
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.004G158700.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Bv5_110870_wcqq.t1 orthology 1 7 112.1 2.2e-25
Bv5_110870_wcqq.t2 orthology 1 7 - -
CgUng002450.1 orthology 0.945 6 120.2 8.3e-28
Cm118330.1 orthology 0.943 5 119.4 2.4e-27
Cs7g26570.1 orthology 0.945 6 120.2 9.1e-28
FvH4_5g12320.1 orthology 1 5 118.6 2.5e-27
Manes.05G138100.1 orthology 0.714 2 109 2.3e-24
PGSC0003DMP400010112 orthology 0.806 2 125.2 2.9e-29
Solyc03g119630.2.1 orthology 0.846 3 120.6 7.1e-28
capan_pan_p000343 orthology 0.973 3 - -
cucsa_pan_p010693 orthology 1 7 119 2.34e-36
maldo_pan_p026714 orthology 1 5 117 3.02e-35
thecc_pan_p001600 orthology 0.948 6 131 2.29e-40
vitvi_pan_p014384 orthology 0.833 5 134 4e-41