Gene phavu.G19833.gnm2.ann1.Phvul.004G161300.1
Sequence ID | phavu.G19833.gnm2.ann1.Phvul.004G161300.1 add to my list | ||
---|---|---|---|
Species | Phaseolus vulgaris | ||
Alias | No gene alias | ||
Length | 136aa | ||
Gene Ontology |
![]()
|
Length: 136 amino acids
>phavu.G19833.gnm2.ann1.Phvul.004G161300.1_PHAVU MGKLGRMLDTFCLSFGSNTCFCMNSMEFEDEFEKKPLIVSASSDHKLRLKDVVDGKQTLA FQLKPQIVTLRVSMHCYGCAKKVEKHISKLEGVSSYKVDLETKIVVVMGDILPSEVLQSV SKVKNAELWKSQGSKQ
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.004G161300.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
MELO3C025323.2.1 | orthology | 0.554 | 3 | 107.1 | 7.8e-24 |
cajca.ICPL87119.gnm1.ann1.C.cajan_27569.1 | orthology | 0.0972 | 2 | 246.5 | 1.1e-65 |
cucsa_pan_p016074 | orthology | 0.539 | 3 | 172 | 1.12e-56 |
soybn_pan_p021997 | orthology | 0.0526 | 2 | 253 | 1.41e-88 |