Gene phavu.G19833.gnm2.ann1.Phvul.005G095400.1
Sequence ID | phavu.G19833.gnm2.ann1.Phvul.005G095400.1 add to my list | ||
---|---|---|---|
Species | Phaseolus vulgaris | ||
Alias | No gene alias | ||
Length | 142aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 142 amino acids
>phavu.G19833.gnm2.ann1.Phvul.005G095400.1_PHAVU MTIIEMRVHMDCPGCENKVKAALQKLKGVDDIEIDMKLQKVTVNGYAEQKKVLKTVRKTG CRAELWQLPYTTESQNQYFQQHHCNGPLTYYASQPSSSYNYYKHGYDSSDPRYYNYPSQS SIFGHQTGATFSDDNPHACVIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.005G095400.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT1G06330.1 | orthology | 0.583 | 7 | 182.2 | 2.3e-46 |
Cg2g008690.1 | orthology | 0.489 | 6 | 214.5 | 4e-56 |
Cm103060.1 | orthology | 0.484 | 7 | 214.9 | 5.2e-56 |
Cs2g15540.1 | orthology | 0.484 | 7 | 218 | 3.9e-57 |
FvH4_6g27360.1 | orthology | 0.567 | 6 | 181.4 | 3.9e-46 |
MELO3C018725.2.1 | orthology | 0.644 | 7 | 184.5 | 4e-47 |
Manes.15G048400.1 | orthology | 0.319 | 3 | 226.1 | 1.6e-59 |
brana_pan_p013116 | orthology | 0.56 | 8 | 180 | 5.81e-59 |
braol_pan_p024201 | orthology | 0.56 | 8 | 180 | 5.27e-59 |
brarr_pan_p028890 | orthology | 0.56 | 8 | 180 | 4.69e-59 |
cajca.ICPL87119.gnm1.ann1.C.cajan_23872.1 | orthology | 0.0802 | 2 | 268.1 | 3.6e-72 |
cucsa_pan_p019751 | orthology | 0.635 | 7 | 181 | 4.33e-60 |
medtr_pan_p000903 | orthology | 0.172 | 2 | 261 | 2.43e-91 |
soybn_pan_p032804 | orthology | 0.0817 | 2 | 276 | 2.3e-97 |
thecc_pan_p014674 | orthology | 0.365 | 6 | 170 | 1.31e-55 |
vitvi_pan_p026446 | orthology | 0.503 | 6 | 210 | 3.34e-71 |