Gene phavu.G19833.gnm2.ann1.Phvul.007G103800.1


Sequence ID phavu.G19833.gnm2.ann1.Phvul.007G103800.1  add to my list
Species Phaseolus vulgaris
Alias No gene alias
Length 82aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 82 amino acids

>phavu.G19833.gnm2.ann1.Phvul.007G103800.1_PHAVU
MSQTVVLKVEMSCEGCVGAVKRVLGKLDGVESYDIDLKEKKVVVKGNVQPDTVLQTVSKT
GKKTTFWEGEAAASATSTVTAA




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.007G103800.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
cajca.ICPL87119.gnm1.ann1.C.cajan_24641.1 orthology 0.0626 1 128.3 2.6e-30
soybn_pan_p011435 orthology 0.0846 2 145 2.01e-47
soybn_pan_p033763 orthology 0.0852 2 - -
thecc_pan_p006409 orthology 0.316 3 124 2.62e-39
vitvi_pan_p027163 orthology 0.414 4 - -
vitvi_pan_p043448 orthology 0.43 4 - -
vitvi_pan_p043537 orthology 0.414 4 - -