Gene phavu.G19833.gnm2.ann1.Phvul.008G010200.1
Sequence ID | phavu.G19833.gnm2.ann1.Phvul.008G010200.1 add to my list | ||
---|---|---|---|
Species | Phaseolus vulgaris | ||
Alias | No gene alias | ||
Length | 145aa | ||
Gene Ontology |
![]()
|
Length: 145 amino acids
>phavu.G19833.gnm2.ann1.Phvul.008G010200.1_PHAVU MGALTNIISNFCTVPSRKIKTMQTVEIKVKMDCDGCERKVRNAVAKMKGVKSVEINRKQS RVTVNGCVDPNKVLNRVKRTGKKRAEFWPYVPQHVVTYPHASGVYDKRAPSGYVRNMQSF TPSAETEEKFMSLFSEDNVNACSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.008G010200.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
cajca.ICPL87119.gnm1.ann1.C.cajan_19048.1 | orthology | 0.144 | 2 | 262.3 | 2e-70 |
cicar_pan_p020432 | orthology | 0.242 | 4 | 237 | 4.48e-82 |
medtr_pan_p015314 | orthology | 0.251 | 4 | 231 | 3.82e-79 |
phavu.G19833.gnm2.ann1.Phvul.004G077300.1 | ultra-paralogy | 0.223 | 0 | - | - |
phavu.G19833.gnm2.ann1.Phvul.006G017000.1 | ultra-paralogy | 0.186 | 0 | - | - |
phavu.G19833.gnm2.ann1.Phvul.L002137.1 | ultra-paralogy | 0.227 | 0 | - | - |
soybn_pan_p030977 | orthology | 0.0847 | 1 | 274 | 1.66e-96 |