Gene phavu.G19833.gnm2.ann1.Phvul.008G219600.1
| Sequence ID | phavu.G19833.gnm2.ann1.Phvul.008G219600.1 add to my list | ||
|---|---|---|---|
| Species | Phaseolus vulgaris | ||
| Alias | No gene alias | ||
| Length | 74aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 74 amino acids
>phavu.G19833.gnm2.ann1.Phvul.008G219600.1_PHAVU MANVVEVKVGLHCDECIKKILKAIKKIEDIETYNVDKQLNKVIVTGDVTTEEVIRVLQKI GKNATPWENTQPNC
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP240412 | Unannotated cluster |
| 3 | GP342479 | Unannotated cluster |
| 4 | GP464531 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.008G219600.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| MELO3C019982.2.1 | orthology | 0.608 | 5 | - | - |
| Manes.07G136400.1 | orthology | 0.414 | 4 | - | - |
| cicar_pan_p006875 | orthology | 0.205 | 3 | 130 | 8.24e-42 |
| cucsa_pan_p000399 | orthology | 0.575 | 5 | - | - |
| medtr_pan_p025150 | orthology | 0.225 | 3 | 131 | 3.27e-42 |
| soybn_pan_p012238 | orthology | 0.144 | 1 | - | - |
| soybn_pan_p043843 | orthology | 0.0588 | 1 | 141 | 5.94e-46 |