Gene phavu.G19833.gnm2.ann1.Phvul.010G034132.1
Sequence ID | phavu.G19833.gnm2.ann1.Phvul.010G034132.1 add to my list | ||
---|---|---|---|
Species | Phaseolus vulgaris | ||
Alias | No gene alias | ||
Length | 253aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 253 amino acids
>phavu.G19833.gnm2.ann1.Phvul.010G034132.1_PHAVU MAKEEKKKEEELEVITAIYKVNLHCKECGSKIKKHLMITQGVQSVEIEIEKGEVRAKGKI EPLKILKLIEKKSKKKVELISPKVKPKEITTMDKKPKEIKDPIIRIIVVKVHMHCDKCEA DLKTRLIKHKGIFDVKTDQKAESVTVEGTIEVEKLISFLRKRVHKNVEIVSIKEVKKEEK KGKEEGKSSETTKEKDKGESTKKKGGETTKIIEAREEHQKEEVKIKDNVPYIIHYVYAPQ LFSDENPNSCSIL
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP342504 | Unannotated cluster |
4 | GP464372 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.010G034132.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
FvH4_7g08060.1 | orthology | 0.954 | 4 | - | - |
MELO3C006231.2.1 | orthology | 0.888 | 5 | 142.9 | 2.4e-34 |
Manes.06G027700.1 | orthology | 0.76 | 5 | 160.2 | 1.9e-39 |
cajca.ICPL87119.gnm1.ann1.C.cajan_43449.1 | orthology | 0.133 | 1 | 321.2 | 6.4e-88 |
cucsa_pan_p017527 | orthology | 0.886 | 5 | 182 | 2.97e-57 |
maldo_pan_p031662 | orthology | 0.685 | 3 | 201 | 2.41e-63 |
maldo_pan_p050157 | orthology | 0.95 | 4 | - | - |
soybn_pan_p031851 | orthology | 0.156 | 2 | 326 | 4.57e-113 |
soybn_pan_p035421 | orthology | 0.222 | 2 | - | - |