Gene phavu.G19833.gnm2.ann1.Phvul.011G084200.1
Sequence ID | phavu.G19833.gnm2.ann1.Phvul.011G084200.1 add to my list | ||
---|---|---|---|
Species | Phaseolus vulgaris | ||
Alias | No gene alias | ||
Length | 287aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 287 amino acids
>phavu.G19833.gnm2.ann1.Phvul.011G084200.1_PHAVU MGAKKKTGGGNGNKENQDAATTVVLKLDFHCDGCASKIIRHLRSFQGVETVKAEDGVGKV TVTGKVDPVKLRDNLAEKMKKKVEIVSPQTKKEKEKEKEENKDTKANNKTQDKKNKDKEV VTTAVLKMALHCQGCLDRIGKTVLKTKGVQEMAIDKEKETVTVKGTMDVKALVENLTEKL KRKVEVVPPKKEKDADKDKEGSGNKKKKGGGGGGGGGDTNEEGVEKIDYSRMEYVPQPSF GFGYGYGHGNIGGYSYVPVYPEQMQFHLHAPAPQIFSDENPNACSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.011G084200.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT5G60800.2 | orthology | 0.802 | 3 | 151.4 | 8.7e-37 |
brana_pan_p000516 | orthology | 0.902 | 4 | 214 | 1.13e-68 |
brana_pan_p055950 | orthology | 0.863 | 4 | - | - |
brana_pan_p067841 | orthology | 0.866 | 4 | - | - |
braol_pan_p002717 | orthology | 1 | 4 | - | - |
braol_pan_p017567 | orthology | 0.902 | 4 | 197 | 2.31e-62 |
braol_pan_p040048 | orthology | 0.863 | 4 | - | - |
brarr_pan_p004266 | orthology | 0.886 | 3 | 208 | 2.29e-66 |
brarr_pan_p006703 | orthology | 0.869 | 4 | - | - |
brarr_pan_p008731 | orthology | 1 | 4 | - | - |
brarr_pan_p020733 | orthology | 1 | 4 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_21570.1 | orthology | 0.296 | 2 | 176 | 3.8e-44 |
soybn_pan_p023786 | orthology | 0.198 | 2 | - | - |
soybn_pan_p027875 | orthology | 0.436 | 2 | - | - |
soybn_pan_p029836 | orthology | 0.193 | 2 | 342 | 1.28e-118 |