Gene sorbi_pan_p001968


Sequence ID sorbi_pan_p001968  add to my list
Species Sorghum bicolor
Alias No gene alias
Pangenome status Core (2/2)
Length 124aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 124 amino acids

>sorbi_pan_p001968_SORBI
MADMQIVLAGRKIEAQYVEMKVPLYSYGCEKKIKKALSHLKGIHSVQVDYHQQKVTVWGI
CNRDDVLAAVRKKRRDARFWNGDELGLGEHVPPTPGEAPKQYLAAFTAYRLRKSWKKLFP
LIRL


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP342521 Unannotated cluster
4 GP467872 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for sorbi_pan_p001968



Represented sequence(s):
SORBI_BTx623_v3.1.1
Sobic.006G190600.2
SORBI_Tx430_v1.0
3381.casb003g061450.635.1
Download sequences FASTA



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Mba04_g24060.1 orthology 0.531 4 162 7.94e-53
Sspon.05G0023740-1B orthology 0.0183 1 - -
Sspon.05G0023740-1P orthology 0.0183 2 - -
Sspon.05G0023740-2D orthology 0.0183 2 247 4.69e-86
XP_008808278.1 orthology 0.618 4 165 5.32e-54
XP_010919018.1 orthology 0.625 5 163 3.26e-53
XP_010934032.1 orthology 0.583 4 - -
cocnu_pan_p020678 orthology 0.599 4 161 1.74e-52
cocnu_pan_p024529 orthology 0.673 5 - -
musac_pan_p009117 orthology 0.546 4 163 3.06e-53