Gene sorbi_pan_p004683
Sequence ID | sorbi_pan_p004683 add to my list | ||
---|---|---|---|
Species | Sorghum bicolor | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 177aa | ||
Gene Ontology |
![]()
|
Length: 177 amino acids
>sorbi_pan_p004683_SORBI MGGAMRQLLSFLRAINGRPREKKRKTTTTTLRRRRLVQTVVELRVRMDCERCEREVKKAL SGIRGVQHVEVNRLQQKVTVTGEVDPAAVLRRAQSTGKKAEPWPGPGPQSTAGYYGPSAA ALYGFGAAQLQAHDGRWANPAGYYYPYYPAPVMEAAIGAEQITSLFSDDNPNACSVM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for sorbi_pan_p004683
Represented sequence(s):
SORBI_Tx430_v1.0
SORBI_BTx623_v3.1.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HanXRQChr11g0339531 | orthology | 1 | 4 | - | - |
Sspon.04G0003210-2C | orthology | 0.178 | 2 | 259 | 2.81e-89 |
bradi_pan_p043115 | orthology | 0.672 | 5 | 130 | 3.73e-39 |
maize_pan_p029187 | orthology | 0.193 | 1 | 238 | 5.98e-81 |
orysa_pan_p045119 | orthology | 0.683 | 5 | 152 | 2.72e-47 |
tritu_pan_p006814 | orthology | 0.623 | 4 | - | - |
tritu_pan_p048029 | orthology | 0.606 | 4 | 144 | 2.18e-44 |