Gene sorbi_pan_p005993
| Sequence ID | sorbi_pan_p005993 add to my list | ||
|---|---|---|---|
| Species | Sorghum bicolor | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 165aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 165 amino acids
>sorbi_pan_p005993_SORBI MLRFWRTQRSTTSSNALSVSEPIPDRTSMRKTTVVEMNVHMDCDGCEKRVRKAMSRLQGV SSVEIDMDRQKVTVTGYVDRREVLRAARRTGRAAEFWPWPYDGEYYPFAIQYLEDNTYMA TDRYYRHGYNDPMIGSYPCHAFTHVIDDDALAVFHVDNVHACAVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP489883 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for sorbi_pan_p005993
Represented sequence(s):
SORBI_BTx623_v3.1.1
SORBI_Tx430_v1.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Dr00501 | orthology | 0.685 | 3 | 201 | 7.68e-67 |
| Mba02_g11510.1 | orthology | 0.688 | 3 | 150 | 8.31e-48 |
| XP_008783549.1 | orthology | 0.636 | 5 | 206 | 5.73e-69 |
| XP_010934033.1 | orthology | 0.577 | 5 | 203 | 4.99e-68 |
| cocnu_pan_p034578 | orthology | 0.615 | 4 | 192 | 3.99e-64 |
| musac_pan_p001552 | orthology | 0.638 | 3 | 191 | 3.8e-63 |