Gene sorbi_pan_p010670
| Sequence ID | sorbi_pan_p010670 add to my list | ||
|---|---|---|---|
| Species | Sorghum bicolor | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 213aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 213 amino acids
>sorbi_pan_p010670_SORBI MAPLLFRDMKGLSCSSQASTAICPSLERQPMVRSHKAIASPSPSPSPLAHAPAEPRTHRH DGKKGQQQQHKAVVVPNITGGLVSPAGSSRYLLSSGRFAATVTEEIQEVVESAPAPAPAV DAKREEASEAAEAKSGAQAQEQVVVLKVSLHCKACAGKVKKHLSKMEGVTSFNIDFAAKK VTVVGDVTPLGVLNSVSKVKNAQLWAAPPAIAA
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for sorbi_pan_p010670
Represented sequence(s):
SORBI_Tx430_v1.0
SORBI_BTx623_v3.1.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Sspon.01G0031200-1A | orthology | 0.0325 | 1 | - | - |
| Sspon.01G0031200-1P | orthology | 0.033 | 1 | 357 | 6.58e-127 |
| Sspon.01G0031200-2B | orthology | 0.0313 | 1 | - | - |
| Sspon.01G0031200-3D | orthology | 0.0369 | 1 | - | - |
| maize_pan_p014397 | orthology | 0.383 | 2 | - | - |
| maize_pan_p019962 | orthology | 0.104 | 2 | - | - |
| maize_pan_p032298 | orthology | 0.198 | 2 | - | - |
| maize_pan_p043327 | orthology | 0.357 | 2 | - | - |