Gene sorbi_pan_p013767
| Sequence ID | sorbi_pan_p013767 add to my list | ||
|---|---|---|---|
| Species | Sorghum bicolor | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 155aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 155 amino acids
>sorbi_pan_p013767_SORBI MGIVDVVSEYCSLPRSRRHLKKRKQFQTVEMKVRIDCEGCERKVKKALEDMKGVSSVEVT AKQNKVTVTGYVDAGKVMRRVAYKTGKRVEPWPYVPYEMVAHPYAPGAYDKKAPAGYVRD VVADPTAAPLARASSTEVRYTAAFSDENPNACAVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for sorbi_pan_p013767
Represented sequence(s):
SORBI_BTx623_v3.1.1
SORBI_Tx430_v1.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Mba04_g22800.1 | orthology | 0.399 | 3 | 233 | 3.72e-80 |
| Mba04_g33020.1 | orthology | 0.439 | 3 | - | - |
| Sspon.05G0013620-1A | orthology | 0.0261 | 1 | - | - |
| musac_pan_p005239 | orthology | 0.439 | 3 | 232 | 1.17e-79 |
| musac_pan_p034720 | orthology | 0.44 | 3 | - | - |