Gene sorbi_pan_p016766


Sequence ID sorbi_pan_p016766  add to my list
Species Sorghum bicolor
Alias No gene alias
Pangenome status Core (2/2)
Length 69aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 69 amino acids

>sorbi_pan_p016766_SORBI
MAVVELKVGMHCERCIKAIKKAIKTIDDMESYHLETEINKVTVTGNVTPEEVVKALHKIG
KTATCWAED


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP240412 Unannotated cluster
3 GP342479 Unannotated cluster
4 GP464531 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for sorbi_pan_p016766



Represented sequence(s):
SORBI_Tx430_v1.0
3381.casb001g017620.635.1
SORBI_BTx623_v3.1.1
Sobic.003G341000.1
Download sequences FASTA



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
XP_008799824.1 orthology 0.734 4 114 2.02e-35
XP_019706214.1 orthology 0.581 3 112 1.24e-34
XP_019706215.1 orthology 0.601 3 - -
maize_pan_p022379 orthology 0.125 1 134 2.54e-43
maize_pan_p029941 orthology 0.616 1 - -
maize_pan_p040990 orthology 0.64 1 - -
musac_pan_p017294 orthology 0.774 4 108 4.31e-33