Gene sorbi_pan_p025511
Sequence ID | sorbi_pan_p025511 add to my list | ||
---|---|---|---|
Species | Sorghum bicolor | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 168aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 168 amino acids
>sorbi_pan_p025511_SORBI MGGTLEYLSGLLGVGGSGSHDHENKKKKRKQLQTVELKVRMDCEGCELKVRSTLSSMKGV ESVEINRKQQKVTVVGYVEATKVLKKAQSTGKKAELWPYVPYNLVAQPYVAGTYDKRAPP GYVRSVEPAAGYVVAASSQLQAAAGGRPPGDHLTDMFNDENPNSCSVM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for sorbi_pan_p025511
Represented sequence(s):
SORBI_Tx430_v1.0
SORBI_BTx623_v3.1.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Mba07_g10470.1 | orthology | 0.591 | 3 | - | - |
Sspon.02G0033800-1B | orthology | 0.0584 | 1 | 263 | 3.2e-91 |
Sspon.02G0033800-2C | orthology | 0.0777 | 1 | - | - |
XP_008798426.1 | orthology | 0.43 | 3 | - | - |
XP_010916917.1 | orthology | 0.417 | 3 | - | - |
XP_010926254.1 | orthology | 0.495 | 4 | 206 | 7.31e-69 |
cocnu_pan_p024481 | orthology | 0.517 | 4 | - | - |
cocnu_pan_p026004 | orthology | 0.414 | 3 | - | - |
cocnu_pan_p035557 | orthology | 0.516 | 3 | - | - |
musac_pan_p025676 | orthology | 0.606 | 3 | - | - |