Gene sorbi_pan_p027660


Sequence ID sorbi_pan_p027660  add to my list
Species Sorghum bicolor
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 179aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 179 amino acids

>sorbi_pan_p027660_SORBI
MAPVILRMDVHCFCYGCAGKIRRVVKNLLAGVEEVWVSVDTGLVVVAGTSLDASLLRWRI
QTRTRRPVTVVSDGADPEPQPQYQYAAPPPGYPQHYHYSGMQYMGPPPSAPPPTPTTAAA
ATGCPRRRHSTCSSTCRRRRRRLGTMVTSPRASTCPTRPPCASTTTTPTAAAPCSDPPS




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP245789 Unannotated cluster
3 GP349846 Unannotated cluster
4 GP475099 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for sorbi_pan_p027660



Represented sequence(s):
SORBI_BTx623_v3.1.1
Sobic.001G025201.1
Unrepresented genome(s):
SORBI_Tx430_v1.0


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_19_940.1 orthology 1 2 - -
Ca_24_338.2 orthology 1 2 - -
Ca_48_570.1 orthology 1 2 - -
Ca_67_416.1 orthology 1 2 - -
Ca_72_670.1 orthology 1 2 - -
Ca_73_14.2 orthology 1 3 - -
Ca_74_94.1 orthology 1 3 - -
Ca_81_33.3 orthology 1 3 - -
Ca_85_991.1 orthology 1 3 - -
Ca_90_4.2 orthology 1 2 - -
Ca_9_295.1 orthology 1 3 - -
Ca_9_642.2 orthology 1 3 - -
Cc02_g08260 orthology 1 3 - -
Cc04_g13830 orthology 1 3 - -
HanXRQChr09g0250511 orthology 1 3 - -
HanXRQChr16g0528781 orthology 1 3 - -
maize_pan_p023480 orthology 0.444 1 - -