Gene sorbi_pan_p029803


Sequence ID sorbi_pan_p029803  add to my list
Species Sorghum bicolor
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 90aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 90 amino acids

>sorbi_pan_p029803_SORBI
MDYRQPYCMTLRMNIDCNGCYQRIRRALLQMQELESHLIDKKHGRVIVCGVFSPQDVAIK
IRKRTNRRVEILDVSEVSPPAPEGAPGHMP




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP109350 Unannotated cluster
3 GP119142 Unannotated cluster
4 GP077996 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for sorbi_pan_p029803



Represented sequence(s):
SORBI_BTx623_v3.1.1
Sobic.002G197400.1
Unrepresented genome(s):
SORBI_Tx430_v1.0


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
ORGLA09G0073900.1 orthology 0.471 5 - -
bradi_pan_p028263 orthology 0.407 4 136 2.42e-43
maize_pan_p009159 orthology 0.152 1 165 5.42e-55
musac_pan_p023320 orthology 0.694 3 113 2.2e-34
orysa_pan_p037625 orthology 0.578 5 - -
tritu_pan_p004118 orthology 0.326 3 - -
tritu_pan_p024914 orthology 0.317 3 142 1.19e-45
tritu_pan_p040052 orthology 0.306 3 - -
tritu_pan_p048949 orthology 0.4 3 - -