Gene soybn_pan_p011435
Sequence ID | soybn_pan_p011435 add to my list | ||
---|---|---|---|
Species | Glycine max | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 81aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 81 amino acids
>soybn_pan_p011435_SOYBN MSQTVVLKVGMSCEGCVGAVKRVLGKLDGVESYDIDLKEQKVVVKGNVQPDTVLQTVSKT GKKTTFWEGEAATSETSTATA
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP239638 | Unannotated cluster |
3 | GP341755 | Unannotated cluster |
4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p011435
Represented sequence(s):
SOYBN_Wm82_a2_v1.0
SOYBN_ZH13
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
cajca.ICPL87119.gnm1.ann1.C.cajan_24641.1 | orthology | 0.0968 | 2 | 126 | 4.45e-40 |
phavu.G19833.gnm2.ann1.Phvul.007G103800.1 | orthology | 0.0846 | 2 | 145 | 1.33e-47 |
soybn_pan_p033763 | ultra-paralogy | 0.0327 | 0 | - | - |
thecc_pan_p006409 | orthology | 0.298 | 2 | 129 | 3.57e-41 |
vitvi_pan_p027163 | orthology | 0.396 | 3 | - | - |
vitvi_pan_p043448 | orthology | 0.412 | 3 | - | - |
vitvi_pan_p043537 | orthology | 0.396 | 3 | - | - |