Gene soybn_pan_p011435


Sequence ID soybn_pan_p011435  add to my list
Species Glycine max
Alias No gene alias
Pangenome status Core (2/2)
Length 81aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 81 amino acids

>soybn_pan_p011435_SOYBN
MSQTVVLKVGMSCEGCVGAVKRVLGKLDGVESYDIDLKEQKVVVKGNVQPDTVLQTVSKT
GKKTTFWEGEAATSETSTATA


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for soybn_pan_p011435



Represented sequence(s):
SOYBN_Wm82_a2_v1.0
Glyma10g34880.2
SOYBN_ZH13
SoyZH13_10G187300.m1
Download sequences FASTA



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
cajca.ICPL87119.gnm1.ann1.C.cajan_24641.1 orthology 0.0968 2 126 4.45e-40
phavu.G19833.gnm2.ann1.Phvul.007G103800.1 orthology 0.0846 2 145 1.33e-47
soybn_pan_p033763 ultra-paralogy 0.0327 0 - -
thecc_pan_p006409 orthology 0.298 2 129 3.57e-41
vitvi_pan_p027163 orthology 0.396 3 - -
vitvi_pan_p043448 orthology 0.412 3 - -
vitvi_pan_p043537 orthology 0.396 3 - -